discuss The official Longest Domain Showcase & Discussion Thread.

[skylineleong]

Why & what you register longest domain?

Who have longest sales before?

What you think is longest domain in your mind? (Exp: 30 above or less than 30)


========================================================


26 of 63x Same Letter buyout since year 2000 before


========================================================


I have 10 years old longest domain since 2000

63 x "Y"



WWW.YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY.COM


========================================================



A valid domain name:
Does not contain invalid characters - Only letters, numbers, or hyphens are allowed.
Max = less than 64 characters.



========================================================

Longest Sales Report

Both 32 characters
auslandsreise-krankenversicherung.de
$529
2008-05-14
sedo.com

newyorkmedicalmalpracticeattorney.com
$583
2008-04-14
tdnam.com

 

[DavidH]

Longest sold name is a 26 letter dot com

Data Recovery Software For Mac


Longest currently registered name is 31 letter dot com:

California Long Term Care Insurance


Other long dot coms include:

Healthcare Management Software
Investing In Commercial Real Estate
Marketing Communication Agency
Universal Garage Door Remote
Non Destructive Data Recovery

 

[gazzip]

Here's the longest signpost I have ever seen, its a place in Wales and the domain is in use.

On website

"Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world. It was registered by Internetters on 21st October 1999"



http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/


EEEEK :hehe: ...don't ask me to pronounce it !





.

 

[skylineleong]

"Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world. It was registered by Internetters on 21st October 1999"

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/
.

Reference from http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world. It was registered by Internetters on 21st October 1999.

This Welsh town actually exists and its name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".

For brevity, it is understandable that many of the locals simply refer to their village as "Llanfair" www.llanfair.com or "Llanfair PG" or "Llanfairpwll" which, of course, makes for easier typing and is faster to pronounce.

Prior to October 1999 it was not possible to register .com domain names longer than 26 characters (including 4 for the .com suffix). This denied many businesses and organisations the ability to register their full trading names as a .com domain name. However in October 1999, it became possible to register domain names up to 67 characters in length (including the 4 for the .com suffix).

Companies with names such as Cheltenham and Gloucester were then able to secure their trading names
with a .com suffix www.cheltenhamandgloucester.com (27 characters).

For more information about places of interest or associated with llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

There is a station in Wales called Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion but this is well less known.

And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.

Other long names (but not place names) include words such as Pneumonoultramicroscopicsilicovolcanokoniosis (and many others)

Thailand allow reg 163 characters long

 

[kukgle]

Reference from http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/




Thailand allow reg 163 characters long

There contains around 23 words. The actual meaning is 'Bangkok, the big city of this era'.... bra bra bra...

 

[skylineleong]

http://www.namepros.com/domain-appr...-names-please-appraise.html?highlight=longest

ReallyCheapAirlineTicketReallyCheapAirlineTicket.com


http://estibot.com/results.php?domain=ReallyCheapAirlineTicketReallyCheapAirlineTicket.com

http://EstiBot.com Domain Appraisal USD 290

??

 

[GF]

I almost regged:

HumptyDumptySatOnAWallHumptyDumptyHadAGreatFallAllTheKingsHorsesAndAllTheKingsMenCouldntPutHumptyTogetherAgain.mobi

 

[skylineleong]

I find another longest working site
http://thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com/



##################################################

So what is the longest URL in the world?

Well, why? We do not know, but we spent some time creating the longest URL that would be supported and here is what we came up with:Characters: 263

http://thelongestlistofthelongestst...gyandhasnorealpointbutwehadtodoitanyways.html

http://www.thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com/wearejustdoingthistobestupidnowsincethiscangoonforeverandeverandeverbutitstilllookskindaneatinthebrowsereventhoughitsabigwasteoftimeandenergyandhasnorealpointbutwehadtodoitanyways.html

##################################################

Update: It has come to our attention that longer URLs do exist. 263 characters was the longest we could create manually, but we found URLs with over 1700 characters that were generated. It seems the count can be infinite.

http://www.google.com/search?hl=en&lr=&c2coff=1&rls=GGLG%2CGGLG%3A2005-26%2CGGLG%3Aen&q=http%3A%2F%2Fwww.google.com%2Fsearch%3Fhl%3Den%26lr%3D%26c2coff%3D1%26rls%3DGGLG%252CGGLG%253A2005-26%252CGGLG%253Aen%26q%3Dhttp%253A%252F%252Fwww.google.com%252Fsearch%253Fhl%253Den%2526lr%253D%2526c2coff%253D1%2526rls%253DGGLG%25252CGGLG%25253A2005-26%25252CGGLG%25253Aen%2526q%253Dhttp%25253A%25252F%25252Fwww.google.com%25252Fsearch%25253Fsourceid%25253Dnavclient%252526ie%25253DUTF-8%252526rls%25253DGGLG%25252CGGLG%25253A2005-26%25252CGGLG%25253Aen%252526q%25253Dhttp%2525253A%2525252F%2525252Fwww%2525252Egoogle%2525252Ecom%2525252Fsearch%2525253Fsourceid%2525253Dnavclient%25252526ie%2525253DUTF%2525252D8%25252526rls%2525253DGGLG%2525252CGGLG%2525253A2005%2525252D26%2525252CGGLG%2525253Aen%25252526q%2525253Dhttp%252525253A%252525252F%252525252Fuk2%252525252Emultimap%252525252Ecom%252525252Fmap%252525252Fbrowse%252525252Ecgi%252525253Fclient%252525253Dpublic%2525252526GridE%252525253D%252525252D0%252525252E12640%2525252526GridN%252525253D51%252525252E50860%2525252526lon%252525253D%252525252D0%252525252E12640%2525252526lat%252525253D51%252525252E50860%2525252526search%252525255Fresult%252525253DLondon%25252525252CGreater%252525252520London%2525252526db%252525253Dfreegaz%2525252526cidr%252525255Fclient%252525253Dnone%2525252526lang%252525253D%2525252526place%252525253DLondon%252525252CGreater%252525252BLondon%2525252526pc%252525253D%2525252526advanced%252525253D%2525252526client%252525253Dpublic%2525252526addr2%252525253D%2525252526quicksearch%252525253DLondon%2525252526addr3%252525253D%2525252526scale%252525253D100000%2525252526addr1%252525253D%2526btnG%253DSearch%26btnG%3DSearch&btnG=Search

 

[loscocco]

i used to own and sold RenewableSourcesofEnergy.com

 

[FathomJH]

I recall someone on this forum bought:

supercalifragilisticexpialidocious[.]mobi a couple years back.

 

[skylineleong]

Iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com



##############################################


.MUSEUM would be the longest TLD



##############################################

http://www.home-house-apartment-car-auto-movers-moving-companies.com

 

[RossR]

I saw somebody register:
141592653589793238462643383279502884197169399375105820974944592.com

This is PI: 3.1415...

 

[Coopey]

Here's the longest signpost I have ever seen, its a place in Wales and the domain is in use.

On website

"Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world. It was registered by Internetters on 21st October 1999"



http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/


EEEEK :hehe: ...don't ask me to pronounce it !





.

It's easy to pronounce!
But then I have the advantage of being able to speak some Welsh...

 

[owntype]

SEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEXSEX.COM

Slogan: The most sex you can have on Internet.


YAHOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO!

:gn:

 

[skylineleong]

I saw somebody register:
141592653589793238462643383279502884197169399375105820974944592.com

This is PI: 3.1415...

ET Numeric Language. So hard to remember.

I think better using no_url_shorteners to shorten it.

 

[primavera]

I sold an eighteen letter .com for some good $ a while back. Even the alphabet backwards has been regged since 1999.