domain llanfairpwllgwyngyllgogerychwyrndrobwllllantysilio gogogoch.biz

[pratiknaik]

Update : I already have the site running
http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.biz/

Appriase : llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.biz

Wait wait wait ! I didn't forget my senses at pub last night !

http://en.wikipedia.org/wiki/Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

.com/net/org/info/us taken ! .biz dropped

Just fun to register the longest one word domain that has a meaning !

-Pratik

 

[webfreak]

Offering to the registrant of another extension would be your best bet for any real value. A novelty at best, IMO. Perhaps there was a reason why .biz dropped?

 

[Jammer]

any type ins..LOL

 

[GFX^^]

REG FEE, but if u find a crazy guy that likes th name you could get mid xx

 

[pratiknaik]

Reg fee is 7$ !

But I have a strong/strange feeling that I'll be able to convert this name into some $$$ somehow. Let's see...

-Pratik

 

[chimaera]

I'd love to see if this gets any 'traffic' ... heh.

not worth much/anything, buy enjoy =0)

 

[pratiknaik]

I already have the site running :D

http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.biz/

-Pratik

 

[Razvan]

great domain name :hehe: you just made my day

 

[pratiknaik]

You guys won't believe this, but I've already made 1$ within few hours of reg

-Pratik

 

[Devil_Dog]

rofl, that's great....

You guys won't believe this, but I've already made 1$ within few hours of reg

-Pratik

That's from all of us clicking on it wondering if you've lost your mind. :D

 

[Kate]

Too bad it's .biz TLD :hehe:
Wonder how much type-in you will get :p

 

[Fewski]

:lol:!!

Reg Fee

Well.... Mmmm... Not sure what to say :hehe:

Do you know how to pronouce that? :p

 

[GreenGambler]

you should reg. gogogooch.com along with it, much easier to remember and it can just fwd to .....................................gogogooch.biz

 

[Epic]

Umm, negative reg fee...

Its a beast to type in :p

 

[allabout42]

Wow, I can't believe that there is a village that is named that... Considering that all other extensions are taken, I would have to appriase it at low $xx.

 

[pratiknaik]

Do you know how to pronouce that? :p

No. But I'm really really looking for someone who can pronounce it :D

Its a beast to type in :p

May be that's where the value lies

-Pratik

 

[GreenGambler]

No. But I'm really really looking for someone who can pronounce it :D



May be that's where the value lies

-Pratik

Well the sign has it spelled phonetically, just take it slowly and it's pronouncabe, "llanfair pg" is what the locals call the village accourding to my co-worker who has been there and is sitting next to me currently, He pronounced the whole thing w/o even looking at the sign or text, of course he grew up in Whales.

 

[pratiknaik]

Wow ! May be we could have something for your collegues in upcoming few days

-Pratik

 

[edwinfelix]

Nice name...

$1zillion

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit in Thailand has a better name, but it's too long for .com

 

[pratiknaik]

Have a look at http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.biz

I guess traffic is money. So I'm sure the name would be worth some real $$$

-Pratik